- PET112L Antibody
- Novus Biologicals, a Bio-Techne Brand
- Pricing InfoSupplier PageView Company Product Page
- NBP1-80925
- Human
- This antibody was developed against Recombinant Protein corresponding to amino acids: WKREGKTPGQ IVSEKQLELM QDQGALEQLC HSVMEAHPQV VMDVKNRNPR AINKLIGLVR KATQSRADPV MIKEILEKK
- Western Blot, Immunohistochemistry, Immunocytochemistry/ Immunofluorescence, Immunohistochemistry-Paraffin
- 0.1 ml (also 25ul)
- PET112L
- Rabbit
- HSPC199, PET112L, COXPD41, PET112
- Unconjugated
- PBS (pH 7.2) and 40% Glycerol
- glutamyl-tRNA amidotransferase subunit B
- Novus Biologicals, a Bio-Techne Brand
- IgG
- Polyclonal
- Immunogen affinity purified
- Primary Antibodies
- Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles
Sequence
WKREGKTPGQIVSEKQLELMQDQGALEQLCHSVMEAHPQVVMDVKNRNPRAINKLIGLVRKATQSRADPVMIKEILEKK
Specifications/Features
Available conjugates: Unconjugated